TTC9C antibody (N-Term)

Catalog No. ABIN631689

This anti-TTC9C antibody is a Rabbit Polyclonal antibody detecting TTC9C in WB. Suitable for Human, Mouse and Rat.

Quick Overview for TTC9C antibody (N-Term) (ABIN631689)

Target: TTC9C (Tetratricopeptide Repeat Domain 9C (TTC9C))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TTC9C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TTC9C Antibody

Binding Specificity: N-Term

Specificity: TTC9 C antibody was raised against the N terminal of TTC9

Purification: Affinity purified

Immunogen: TTC9 C antibody was raised using the N terminal of TTC9 corresponding to a region with amino acids MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TTC9C Blocking Peptide, (ABIN5616840), is also available for use as a blocking control in assays to test for specificity of this TTC9C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TTC9C

Target: TTC9C (Tetratricopeptide Repeat Domain 9C (TTC9C))

Alternative Name: TTC9C

Background: The function of TTC9C protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 20 kDa (MW of target protein)